Loading...
Statistics
Advertisement

AYDIN SATRANÇ MERKEZİ
www.aydinsatranc.com/

Aydinsatranc.com

Advertisement
Aydinsatranc.com is hosted in Turkey . Aydinsatranc.com doesn't use HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Html, Iframe, Number of used javascripts: 12. First javascripts: Script.js, Jquery.js, Wppa.js, Number of used analytics tools: 0. Number of used plugins, modules: 8. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Aydinsatranc.com

Technology

Number of occurences: 9
  • CSS
  • Html
  • Iframe
  • Javascript
  • jQuery
  • jQuery Cycle
  • Php
  • Pingback
  • SuperFish

Advertisement

Javascripts

Number of occurences: 12
  • script.js
  • jquery.js
  • wppa.js
  • shutter-reloaded.js
  • jquery.cycle.all.min.js
  • ngg.slideshow.min.js
  • swfobject.js
  • swfaddress.js
  • social.js
  • hoverIntent.min.js
  • superfish.js
  • superfish_settings.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

Used plugins, modules

Number of plugins and modules: 8
  • wp photo album plus
  • nextgen gallery
  • flash album gallery
  • social
  • pixopoint menu
  • wp filebase
  • wp pagenavi
  • wp page numbers

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Aydinsatranc.com

Missing HTTPS protocol.

    Meta - Aydinsatranc.com

    Number of occurences: 3
    • Name:
      Content: IE=EmulateIE7
    • Name: generator
      Content: WordPress 3.5.1
    • Name: GRAND FlAGallery
      Content: 1.77

    Server / Hosting

    • IP: 94.73.146.110
    • Latitude: 41.02
    • Longitude: 28.99
    • Country: Turkey

    Rname

    • ns1.natrohost.com
    • ns2.natrohost.com
    • mx1.aydinsatranc.com
    • mx2.aydinsatranc.com

    Target

    • hostmaster.natrohost.com

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Mon, 02 May 2016 17:16:23 GMT Server: Apache X-Pingback: http://www.aydinsatranc.com/xmlrpc.php Set-Cookie: wpfilebase=1 Location: http://www.aydinsatranc.com/ Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8 HTTP/1.1 200 OK Date: Mon, 02 May 2016 17:16:23 GMT Server: Apache X-Pingback: http://www.aydinsatranc.com/xmlrpc.php Set-Cookie: wpfilebase=1 Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8

    DNS

    host: aydinsatranc.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 94.73.146.110
    host: aydinsatranc.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.natrohost.com
    host: aydinsatranc.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.natrohost.com
    host: aydinsatranc.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns1.natrohost.com
    5. rname: hostmaster.natrohost.com
    6. serial: 2012041509
    7. refresh: 10800
    8. retry: 3600
    9. expire: 777600
    10. minimum-ttl: 3600
    host: aydinsatranc.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx1.aydinsatranc.com
    host: aydinsatranc.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 15
    5. target: mx2.aydinsatranc.com
    host: aydinsatranc.com
    1. class: IN
    2. ttl: 1800
    3. type: TXT
    4. txt: v=spf1 include:_spfcls.natrohost.net include:_spfcls.natrohost.com ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ydinsatranc.com, www.aoydinsatranc.com, www.oydinsatranc.com, www.apydinsatranc.com, www.pydinsatranc.com, www.a9ydinsatranc.com, www.9ydinsatranc.com, www.aydinsatranc.com, www.ydinsatranc.com, www.aiydinsatranc.com, www.iydinsatranc.com, www.auydinsatranc.com, www.uydinsatranc.com, www.adinsatranc.com, www.ayzdinsatranc.com, www.azdinsatranc.com, www.ayadinsatranc.com, www.aadinsatranc.com, www.aysdinsatranc.com, www.asdinsatranc.com, www.ayddinsatranc.com, www.addinsatranc.com, www.aydinsatranc.com, www.adinsatranc.com, www.aycdinsatranc.com, www.acdinsatranc.com, www.ay dinsatranc.com, www.a dinsatranc.com, www.ayinsatranc.com, www.aydtinsatranc.com, www.aytinsatranc.com, www.aydginsatranc.com, www.ayginsatranc.com, www.aydbinsatranc.com, www.aybinsatranc.com, www.aydxinsatranc.com, www.ayxinsatranc.com, www.aydsinsatranc.com, www.aysinsatranc.com, www.aydfinsatranc.com, www.ayfinsatranc.com, www.aydvinsatranc.com, www.ayvinsatranc.com, www.aydyinsatranc.com, www.ayyinsatranc.com, www.aydzinsatranc.com, www.ayzinsatranc.com, www.aydainsatranc.com, www.ayainsatranc.com, www.aydeinsatranc.com, www.ayeinsatranc.com, www.aydrinsatranc.com, www.ayrinsatranc.com, www.aydnsatranc.com, www.aydirnsatranc.com, www.aydrnsatranc.com, www.aydifnsatranc.com, www.aydfnsatranc.com, www.aydivnsatranc.com, www.aydvnsatranc.com, www.aydiknsatranc.com, www.aydknsatranc.com, www.aydi,nsatranc.com, www.ayd,nsatranc.com, www.aydibnsatranc.com, www.aydbnsatranc.com, www.aydignsatranc.com, www.aydgnsatranc.com, www.ayditnsatranc.com, www.aydtnsatranc.com, www.aydiynsatranc.com, www.aydynsatranc.com, www.aydiunsatranc.com, www.aydunsatranc.com, www.aydijnsatranc.com, www.aydjnsatranc.com, www.aydimnsatranc.com, www.aydmnsatranc.com, www.aydinnsatranc.com, www.aydnnsatranc.com, www.aydisatranc.com, www.aydinnsatranc.com, www.aydinsatranc.com, www.aydinhsatranc.com, www.aydihsatranc.com, www.aydinjsatranc.com, www.aydijsatranc.com, www.aydinksatranc.com, www.aydiksatranc.com, www.aydinlsatranc.com, www.aydilsatranc.com, www.aydin satranc.com, www.aydi satranc.com, www.aydinatranc.com, www.aydinseatranc.com, www.aydineatranc.com, www.aydinswatranc.com, www.aydinwatranc.com, www.aydinsdatranc.com, www.aydindatranc.com, www.aydinsxatranc.com, www.aydinxatranc.com, www.aydinsfatranc.com, www.aydinfatranc.com, www.aydinsgatranc.com, www.aydingatranc.com, www.aydinstatranc.com, www.aydintatranc.com, www.aydinstranc.com, www.aydinsaotranc.com, www.aydinsotranc.com, www.aydinsaptranc.com, www.aydinsptranc.com, www.aydinsa9tranc.com, www.aydins9tranc.com, www.aydinsatranc.com, www.aydinstranc.com, www.aydinsaitranc.com, www.aydinsitranc.com, www.aydinsautranc.com, www.aydinsutranc.com, www.aydinsaranc.com, www.aydinsatqranc.com, www.aydinsaqranc.com, www.aydinsataranc.com, www.aydinsaaranc.com, www.aydinsat ranc.com, www.aydinsa ranc.com, www.aydinsatwranc.com, www.aydinsawranc.com, www.aydinsateranc.com, www.aydinsaeranc.com, www.aydinsatzranc.com, www.aydinsazranc.com, www.aydinsatxranc.com, www.aydinsaxranc.com, www.aydinsatcranc.com, www.aydinsacranc.com, www.aydinsatanc.com, www.aydinsatrianc.com, www.aydinsatianc.com, www.aydinsatroanc.com, www.aydinsatoanc.com, www.aydinsatrlanc.com, www.aydinsatlanc.com, www.aydinsatrlanc.com, www.aydinsatlanc.com, www.aydinsatr.anc.com, www.aydinsat.anc.com, www.aydinsatrnc.com, www.aydinsatraonc.com, www.aydinsatronc.com, www.aydinsatrapnc.com, www.aydinsatrpnc.com, www.aydinsatra9nc.com, www.aydinsatr9nc.com, www.aydinsatranc.com, www.aydinsatrnc.com, www.aydinsatrainc.com, www.aydinsatrinc.com, www.aydinsatraunc.com, www.aydinsatrunc.com,

    Other websites we recently analyzed

    1. 至高のネット回線情報ここにあり | 究極に対抗する至高のネット回線情報登場
      Japan - 112.78.117.153
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 5
      Number of meta tags: 3
    2. rwbs.win
      China - 124.16.31.156
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    3. Rigenerare valore sociale - welfare lodigiano di comunità welfare lodigiano di comunità
      San Francisco (United States) - 104.24.97.106
      G Analytics ID: UA-67795264-1
      Server software: cloudflare-nginx
      Technology: BootstrapCDN, Maxcdn, Carousel, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, SVG, Google Analytics, Wordpress
      Number of Javascript: 14
      Number of meta tags: 5
    4. wmed24.com
      Germany - 212.227.247.28
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    5. coachlinkllc.com
      Road Town (Virgin Islands, British) - 208.91.197.46
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    6. Newton County, GA - Pay Traffic Tickets
      Ashburn (United States) - 52.22.197.228
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, jQuery Validate, Modernizr.js
      Number of Javascript: 13
      Number of meta tags: 7
    7. dalimandala.com
      Scottsdale (United States) - 50.63.202.63
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. chefs2you.com
      United States - 192.195.77.236
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    9. Overseesjob
      United Kingdom - 95.215.224.23
      Server software: Microsoft-IIS/7.5
      Technology: BootstrapCDN, CSS, Font Awesome, Html, Javascript, jQuery, SVG
      Number of Javascript: 169
      Number of meta tags: 1
    10. federalcriminalappealslawyers.com
      Scottsdale (United States) - 50.63.202.60
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe

    Check Other Websites